ENCAB000AVV
Antibody against Homo sapiens HNRNPK
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP40387_T100
- Lot ID
- QC40387
- Characterized targets
- HNRNPK (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- Protein A
- Isotype
- IgG
- Antigen description
- The immunogen is a synthetic peptide directed towards the C terminal region of human HNRPK
- Antigen sequence
- YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
- External resources
Characterizations
HNRNPK (Homo sapiens)
not submitted for review by lab
- Caption
- Western blot analysis of lysates from HeLa cells using rabbit polyclonal to HNRNPK
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- hnRNPK_aviva-1_WB_HeLa_Fu.png