ENCAB000AVZ
Antibody against Homo sapiens HNRNPL
Homo sapiens
HeLa, K562, HepG2
characterized to standards
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP40368_P050
- Lot ID
- QC9464
- Characterized targets
- HNRNPL (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- A synthetic peptide directed towards the N terminal region of human HNRNPL
- Antigen sequence
- AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
- Aliases
- xiang-dong-fu:HNRNPL
- External resources
Characterizations
HNRNPL (Homo sapiens)
compliant
- Caption
- Western blot following shRNA against HNRNPL in HepG2 whole cell lysate using HNRNPL specific antibody. Lane 1 is a ladder, lane 2 is HepG2 non-targeting control knockdown, lane 3 and 4 are two different shRNAs against HNRNPL.HNRNPL protein appears as the green arrow, GAPDH serves as a control and appears in red arrow.
- Submitted by
- Xintao Wei
- Lab
- Brenton Graveley, UConn
- Grant
- U54HG007005
- Download
- HNRNPL-HEPG2-fu's.png
HNRNPL (Homo sapiens)
compliant
- Caption
- Western blot following shRNA against HNRNPL in k562 whole cell lysate using HNRNPL specific antibody. Lane 1 is a ladder, lane 2 is k562 non-targeting control knockdown, lane 3 and 4 are two different shRNAs against HNRNPL. HNRNPL protein appears as the green arrow, GAPDH serves as a control and appears in red arrow.
- Submitted by
- Xintao Wei
- Lab
- Brenton Graveley, UConn
- Grant
- U54HG007005
- Download
- HNRNPL-k562-FU'S.png
HNRNPL (Homo sapiens)
HeLa
compliant
- Caption
- Immunoprecipitation from HeLa whole cell lysate and analized by western blot analysis uisng rabbit polyclonal to HNRNPL. Expected molecular weight: 64 kDa, 50 kDa
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- hnRNPL_aviva-3_IP-WB_HeLa_Fu.png
HNRNPL (Homo sapiens)
HepG2
compliant
- Caption
- IP-Western Blot analysis of HepG2 whole cell lysate using HNRNPL specific antibody. Lane 1 is 2% of ten million whole cell lysate input (lane under '10% input') , lane 2 is 20% of IP enrichment using rabbit normal IgG (lane under 'IgG') and lane 3 is 20% IP enrichment using rabbit polyclonal anti-HNRNPL antibody (lanes under 'anti-HNRNPL'). Asterisk indicates heavy chain of antibody.
- Submitted by
- Marcus Ho
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- HNRNPL_HepG2.png
HNRNPL (Homo sapiens)
K562
compliant
- Caption
- IP-Western Blot analysis of K562 whole cell lysate using HNRNPL specific antibody. Lane 1 is 2% of ten million whole cell lysate input (lane under '10% input') , lane 2 is 20% of IP enrichment using rabbit normal IgG (lane under 'IgG') and lane 3 is 20% IP enrichment using rabbit polyclonal anti-HNRNPL antibody (lanes under 'anti-HNRNPL'). Asterisk indicates non-specific band and double asterisk indiecates heavy chain of antibody.
- Submitted by
- Marcus Ho
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- HNRNPL_K562.png